applied peptide synthesizer models 430a, 431 433 (Thermo Fisher)
Thermo Fisher is a verified supplier 
Thermo Fisher manufactures this product 
90
Structured Review
Thermo Fisher
applied peptide synthesizer models 430a, 431 433
Applied Peptide Synthesizer Models 430a, 431 433, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/model+431+peptide+synthesizer/us10420832-270-11-9
Average 90 stars, based on 1 article reviews
Applied Peptide Synthesizer Models 430a, 431 433, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/model+431+peptide+synthesizer/us10420832-270-11-9
Average 90 stars, based on 1 article reviews
applied peptide synthesizer models 430a, 431 433 - by Bioz Stars,
2026-09
90/100 stars
Images
Related Articles
Synthesized:Article Title: Branched Oligopeptides Form Nano-Capsules with Lipid Vesicle Characteristics Article Snippet: .. Peptides were synthesized by solid phase peptide chemistry on 4-(2,4-Dimethoxyphenyl-Fmocaminomethyl) phenoxyacetyl-norleucyl-cross-Linked Ethoxylate Acrylate Resin 3 (Peptides International Inc; Louisville, Kentucky) on a 0.1 mmol scale using Fmoc (N-(9-fluorenyl) methoxycarbonyl)/tert-butyl chemistry on an ABI Article Title: Interaction and Cellular Localization of the Human Host Defense Peptide LL-37 with Lung Epithelial Cells Article Snippet: .. LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) and LL-37C (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC) were synthesized at the Nucleic Acid/Protein Synthesis Unit at the University of British Columbia (UBC) by N -(9-fluorenyl)methoxy carbonyl (Fmoc) chemistry using an Applied Biosystems Article Title: Bradykinin analogs as selective inhibitors of cell activation Article Snippet: .. Preparation of Peptides Peptides analogs of BK were synthesized on an Applied Biosystems Article Title: Branched amphiphilic peptide capsules: Cellular uptake and retention of encapsulated solutes Article Snippet: .. Peptides were synthesized using solid phase peptide chemistry on 4-(2,4-dimethoxyphenyl-Fmoc-aminomethyl) phenoxyacetyl-norleucyl-cross-linked ethoxylate acrylate resin [ 41 ] (Peptides International Inc.; Louisville, Kentucky) on a 0.1 mmol scale using Fmoc (N-(9-fluorenyl) methoxycarbonyl)/tert-butyl chemistry on an ABI Article Title: Thrombostatin Inhibits Induced Canine Coronary Thrombosis Article Snippet: Thrombostatin (RPPGF), an angiotensin converting enzyme metabolite of bradykinin, is an inhibitor of a-thrombin’s ability to activate platelets.. We examined the in vivo pharmacokinetics and pharmacodynamics of thrombostatin in rabbits and its ability to inhibit coronary thrombosis induced by electrolytic injury in dogs.. Plasma half-life of thrombostatin had a t1/2a of 2.6 min and a t1/2b of 24 min in rabbits. Article Title: Aggrecan degradation in human intervertebral disc and articular cartilage Article Snippet: .. The peptides were synthesized on an Applied Biosystems Purification:Article Title: Aggrecan degradation in human intervertebral disc and articular cartilage Article Snippet: .. The peptides were synthesized on an Applied Biosystems High Performance Liquid Chromatography:Article Title: Aggrecan degradation in human intervertebral disc and articular cartilage Article Snippet: .. The peptides were synthesized on an Applied Biosystems |